GATA binding protein 2, Mouse, Clone: 1G5, Abnova™

Catalog No.	Quantity
89-000-676	100 μg

Catalog No. 89-000-676 Supplier Abnova Corporation Supplier No. H00002624M02

Description

Mouse monoclonal antibody raised against a partial recombinant GATA2.

This gene encodes a member of the GATA family of zinc-finger transcription factors that are named for the consensus nucleotide sequence they bind in the promoter regions of target genes. The encoded protein plays an essential role in regulating transcription of genes involved in the development and proliferation of hematopoietic and endocrine cell lineages. Alternative splicing results in multiple transcript variants

Sequence: MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGK

Specifications

• Antigen: GATA binding protein 2
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 1G5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant GATA2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: GATA2
• Gene Accession No.: BC018988
• Gene Alias: MGC2306/NFE1B
• Gene Symbols: GATA2
• Host Species: Mouse
• Immunogen: GATA2 (AAH18988, 1 a.a. ∼ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 2624
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ