germinal center expressed transcript 2, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-016-636	50 μg

Catalog No. 89-016-636 Supplier Abnova Corporation Supplier No. H00257144B01P

Description

Mouse polyclonal antibody raised against a full-length human GCET2 protein.

This gene encodes a protein which may function in signal transduction pathways and whose expression is elevated in germinal cell lymphomas. It contains a putative PDZ-interacting domain, an immunoreceptor tyrosine-based activation motif (ITAM), and two putative SH2 binding sites. In B cells, its expression is specifically induced by interleukin-4. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq

Sequence: MGNSLLRENRRQQNTQEMPWNVRMQSPKQRTSRCWDHHIAEGCFCLPWKKILIFEKRQDSQNENERMSSTPIQDNVDQTYSEELCYTLINHRVLCTRPSGNSAEEYYENVPCKAERPRESLGGTETEYSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSHL

Specifications

• Antigen: germinal center expressed transcript 2
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human GCET2 protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: GCET2
• Gene Accession No.: NM_152785.3
• Gene Alias: GCAT2/HGAL/MGC40441
• Gene Symbols: GCET2
• Host Species: Mouse
• Immunogen: GCET2 (NP_689998.1, 1 a.a. ∼ 178 a.a) full-length human protein.
• Purification Method: Affinity Purified
• Quantity: 50 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 257144
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG