glucagon, Mouse, Clone: 1E2-E6, Abnova™

Catalog No.	Quantity
89-000-679	100 μg

Catalog No. 89-000-679 Supplier Abnova Corporation Supplier No. H00002641M02

Description

Mouse monoclonal antibody raised against a full-length recombinant GCG.

The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon. [provided by RefSeq

Sequence: MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK

Specifications

• Antigen: glucagon
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1E2-E6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant GCG.
• Formulation: PBS with no preservative; pH 7.4
• Gene: GCG
• Gene Accession No.: BC005278
• Gene Alias: GLP1/GLP2/GRPP
• Gene Symbols: GCG
• Host Species: Mouse
• Immunogen: GCG (AAH05278, 1 a.a. ∼ 180 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 2641
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ