Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89022288

GCHFR, Mouse, Clone: 4G6, Abnova™

Catalog No. 89022288 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-022-288 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-022-288 Supplier Abnova Corporation Supplier No. H00002644M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant GCHFR.

GTP cyclohydrolase I feedback regulatory protein binds to and mediates tetrahydrobiopterin inhibition of GTP cyclohydrolase I. The regulatory protein, GCHFR, consists of a homodimer. It is postulated that GCHFR may play a role in regulating phenylalanine metabolism in the liver and in the production of biogenic amine neurotransmitters and nitric oxide. [provided by RefSeq

Sequence: MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKE

Specifications

Antigen GCHFR
Applications ELISA, Immunofluorescence
Classification Monoclonal
Clone 4G6
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant GCHFR.
Formulation PBS with no preservative; pH 7.4
Gene GCHFR
Gene Accession No. NM_005258
Gene Alias GFRP/HsT16933/MGC138467/MGC138469/P35
Gene Symbols GCHFR
Host Species Mouse
Immunogen GCHFR (NP_005249.1, 1 a.a. ∼ 84 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2644
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.