GCHFR, Mouse, Clone: 4G6, Abnova™

Mouse monoclonal antibody raised against a partial recombinant GCHFR.

Supplier:  Abnova Corporation H00002644M01

Catalog No. 89-022-288

Description

GTP cyclohydrolase I feedback regulatory protein binds to and mediates tetrahydrobiopterin inhibition of GTP cyclohydrolase I. The regulatory protein, GCHFR, consists of a homodimer. It is postulated that GCHFR may play a role in regulating phenylalanine metabolism in the liver and in the production of biogenic amine neurotransmitters and nitric oxide. [provided by RefSeq

Sequence: MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKE

Specifications

• Antigen: GCHFR
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_005258
• Gene Symbols: GCHFR
• Immunogen: GCHFR (NP_005249.1, 1 a.a. ∼ 84 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2b κ

• Applications: ELISA, Immunofluorescence
• Clone: 4G6
• Description: Mouse monoclonal antibody raised against a partial recombinant GCHFR.
• Gene: GCHFR
• Gene Alias: GFRP/HsT16933/MGC138467/MGC138469/P35
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 2644
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid