GCLC, Mouse, Clone: 3H1, Abnova™

Mouse monoclonal antibody raised against a partial recombinant GCLC.

Supplier:  Abnova Corporation H00002729M01

Catalog No. 89-022-316

Description

Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. The gene encoding the catalytic subunit encodes a protein of 367 amino acids with a calculated molecular weight of 72.773kDa and maps to chromosome 6. The regulatory subunit is derived from a different gene located on chromosome 1p22-p21. Deficiency of gamma-glutamylcysteine synthetase in human is associated with enzymopathic hemolytic anemia. [provided by RefSeq

Sequence: EGVFPGLIPILNSYLENMEVDVDTRCSILNYLKLIKKRASGELMTVARWMREFIANHPDYKQDSVITDEMNYSLILKCNQIANELCECPELLGSAFRKVKYSGSKTDSSN

Specifications

• Antigen: GCLC
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_001498
• Gene Symbols: GCLC
• Immunogen: GCLC (NP_001489, 528 a.a. ∼ 637 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG1 κ

• Applications: ELISA, Immunofluorescence, Western Blot
• Clone: 3H1
• Description: Mouse monoclonal antibody raised against a partial recombinant GCLC.
• Gene: GCLC
• Gene Alias: GCS/GLCL/GLCLC
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 2729
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid