glial cells missing homolog 1 (Drosophila), Mouse, Clone: 4E8, Abnova™

Catalog No.	Quantity
89-001-085	100 μg

Catalog No. 89-001-085 Supplier Abnova Corporation Supplier No. H00008521M04

Description

Mouse monoclonal antibody raised against a partial recombinant GCM1.

This gene encodes a DNA-binding protein with a gcm-motif (glial cell missing motif). The encoded protein is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein. [provided by RefSeq

Sequence: QQRKRCPNCDGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPKPETKLEAEA*

Specifications

• Antigen: glial cells missing homolog 1 (Drosophila)
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 4E8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant GCM1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: GCM1
• Gene Accession No.: NM_003643
• Gene Alias: GCMA/hGCMa
• Gene Symbols: GCM1
• Host Species: Mouse
• Immunogen: GCM1 (NP_003634, 108 a.a. ∼ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 8521
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ