Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89000682

K(lysine) acetyltransferase 2A, Mouse, Clone: 4D3, Abnova™

Catalog No. 89000682 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-682 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-682 Supplier Abnova Corporation Supplier No. H00002648M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant GCN5L2.

KAT2A, or GCN5, is a histone acetyltransferase (HAT) that functions primarily as a transcriptional activator. It also functions as a repressor of NF-kappa-B (see MIM 164011) by promoting ubiquitination of the NF-kappa-B subunit RELA (MIM 164014) in a HAT-independent manner (Mao et al., 2009 [PubMed 19339690]).[supplied by OMIM

Sequence: KNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK

Specifications

Antigen K(lysine) acetyltransferase 2A
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 4D3
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant GCN5L2.
Formulation PBS with no preservative; pH 7.4
Gene KAT2A
Gene Accession No. BC032743
Gene Alias GCN5/GCN5L2/MGC102791/PCAF-b/hGCN5
Gene Symbols KAT2A
Host Species Mouse
Immunogen GCN5L2 (AAH32743, 738 a.a. ∼ 837 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Transcription Regulation
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 2648
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.