K(lysine) acetyltransferase 2A, Mouse, Clone: 4D3, Abnova™

Mouse monoclonal antibody raised against a partial recombinant GCN5L2.

Supplier:  Abnova Corporation H00002648M01

Catalog No. 89-000-682

Description

KAT2A, or GCN5, is a histone acetyltransferase (HAT) that functions primarily as a transcriptional activator. It also functions as a repressor of NF-kappa-B (see MIM 164011) by promoting ubiquitination of the NF-kappa-B subunit RELA (MIM 164014) in a HAT-independent manner (Mao et al., 2009 [PubMed 19339690]).[supplied by OMIM

Sequence: KNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK

Specifications

• Antigen: K(lysine) acetyltransferase 2A
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC032743
• Gene Symbols: KAT2A
• Immunogen: GCN5L2 (AAH32743, 738 a.a. ∼ 837 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunofluorescence, Western Blot
• Clone: 4D3
• Description: Mouse monoclonal antibody raised against a partial recombinant GCN5L2.
• Gene: KAT2A
• Gene Alias: GCN5/GCN5L2/MGC102791/PCAF-b/hGCN5
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 2648
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2b κ