GCSH, Mouse, Clone: M2, Abnova™

Catalog No.	Quantity
89-022-292	100 μg

Catalog No. 89-022-292 Supplier Abnova Corporation Supplier No. H00002653M02

Description

Mouse monoclonal antibody raised against a full-length recombinant GCSH.

The enzyme system for cleavage of glycine (glycine cleavage system; EC 2.1.2.10), which is confined to the mitochondria, is composed of 4 protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase; MIM 238300), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme; MIM 238310), and L protein (a lipoamide dehydrogenase; MIM 238331). Glycine encephalopathy (GCE; MIM 605899), also called nonketotic hyperglycinemia (NKH), may be due to a defect in any one of these enzymes.[supplied by OMIM

Sequence: MALRVVRSVRALLCTLRAVPLPAAPCPPRPWQLGVGAVRTLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE

Specifications

• Antigen: GCSH
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: M2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant GCSH.
• Formulation: PBS with no preservative; pH 7.4
• Gene: GCSH
• Gene Accession No.: BC000790
• Gene Alias: GCE/NKH
• Gene Symbols: GCSH
• Host Species: Mouse
• Immunogen: GCSH (AAH00790.1, 1 a.a. ∼ 173 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2653
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ