Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001143

growth differentiation factor 3, Mouse, Clone: 1B9, Abnova™

Catalog No. 89001143 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-143 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-143 Supplier Abnova Corporation Supplier No. H00009573M02
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant GDF3.

The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. [provided by RefSeq

Sequence: HRHQLFINFRDLGWHKWIIAPKGFMANYCHGECPFSLTISLNSSNYAFMQALMHAVDPEIPQAVCIPTKLSPISMLYQDNNDNVILRHYEDMVVDECGCG

Specifications

Antigen growth differentiation factor 3
Applications ELISA
Classification Monoclonal
Clone 1B9
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant GDF3.
Formulation PBS with no preservative; pH 7.4
Gene GDF3
Gene Accession No. NM_020634
Gene Symbols GDF3
Host Species Mouse
Immunogen GDF3 (NP_065685, 265 a.a. ∼ 364 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cytokines
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 9573
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.