Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GFRA1, Mouse, Clone: 1G4, Abnova™

Catalog No. 89022301 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-022-301 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-022-301 Supplier Abnova Corporation Supplier No. H00002674M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a full-length recombinant GFRA1.

Glial cell line-derived neurotrophic factor (GDNF) and neurturin (NTN) are two structurally related, potent neurotrophic factors that play key roles in the control of neuron survival and differentiation. The protein encoded by this gene is a member of the GDNF receptor family. It is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor for both GDNF and NTN, and mediates activation of the RET tyrosine kinase receptor. This gene is a candidate gene for Hirschsprung disease. Multiple alternatively spliced transcript variants have been described for this gene. [provided by RefSeq

Sequence: ASDQCLKEQSCSTKYRTLRQCVAGKETNFSLASGLEAKDECRSAMEALKQKSLYNCRCKRGMKKEKNCLRIYWSMYQSLQGNDLLEDS

Specifications

Antigen GFRA1
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 1G4
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant GFRA1.
Formulation PBS with no preservative; pH 7.4
Gene GFRA1
Gene Accession No. NM_005264
Gene Alias GDNFR/GDNFRA/GFR-ALPHA-1/MGC23045/RET1L/RETL1/TRNR1
Gene Symbols GFRA1
Host Species Mouse
Immunogen GFRA1 (NP_005255, 32 a.a. ∼ 119 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2674
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.