GH2, Mouse, Clone: 1E11, Abnova™

Catalog No.	Quantity
89-022-307	100 μg

Catalog No. 89-022-307 Supplier Abnova Corporation Supplier No. H00002689M01

Description

Mouse monoclonal antibody raised against a full-length recombinant GH2.

The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. As in the case of its pituitary counterpart, growth hormone 1, the predominant isoform of this particular family member shows similar somatogenic activity, with reduced lactogenic activity. Mutations in this gene lead to placental growth hormone/lactogen deficiency. [provided by RefSeq

Sequence: FPTIPLSRLFDNAMLRARRLYQLAYDTYQEFEEAYILKEQKYSFLQNPQTSLCFSESIPTPSNRVKTQQKSNLELLRISLLLIQSWLEPVQLLRSVFANSLVYGASDSNVYRHLKDLEEGIQTLMWRLEDGSPRTGQIFNQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF

Specifications

• Antigen: GH2
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1E11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant GH2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: GH2
• Gene Accession No.: BC020760
• Gene Alias: GH-V/GHL/GHV/hGH-V
• Gene Symbols: GH2
• Host Species: Mouse
• Immunogen: GH2 (AAH20760.1, 27 a.a. ∼ 217 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2689
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ