GHR, Mouse, Clone: 3A12, Abnova™

Catalog No.	Quantity
89-022-308	100 μg

Catalog No. 89-022-308 Supplier Abnova Corporation Supplier No. H00002690M01

Description

Mouse monoclonal antibody raised against a partial recombinant GHR.

This gene encodes a protein that is a transmembrane receptor for growth hormone. Binding of growth hormone to the receptor leads to receptor dimerization and the activation of an intra- and intercellular signal transduction pathway leading to growth. A common alternate allele of this gene, called GHRd3, lacks exon three and has been well-characterized. Mutations in this gene have been associated with Laron syndrome, also known as the growth hormone insensitivity syndrome (GHIS), a disorder characterized by short stature. Other splice variants, including one encoding a soluble form of the protein (GHRtr), have been observed but have not been thoroughly characterized. In humans and rabbits, but not rodents, growth hormone binding protein (GHBP) is generated by proteolytic cleavage of the extracellular ligand-binding domain from the mature growth hormone receptor protein. The precise location of this cleavage site has not been determined for the human protein

Sequence: FSGSEATAAILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSF

Specifications

• Antigen: GHR
• Applications: ELISA, In situ PLA, Western Blot
• Classification: Monoclonal
• Clone: 3A12
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant GHR.
• Formulation: PBS with no preservative; pH 7.4
• Gene: GHR
• Gene Accession No.: NM_000163
• Gene Alias: GHBP
• Gene Symbols: GHR
• Host Species: Mouse
• Immunogen: GHR (NP_000154, 19 a.a. ∼ 118 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2690
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ