Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GIPC PDZ domain containing family, member 1 (A02), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant GIPC1.

Manufacturer:  Abnova Corporation H00010755A02

Catalog No. 89-004-513


Add to cart

Description

Description

GIPC1 is a scaffolding protein that regulates cell surface receptor expression and trafficking (Lee et al., 2008 [PubMed 18775991]).[supplied by OMIM

Sequence: HTQLAHGSPTGRIEGFTNVKELYGKIAEAFRLPTAEVMFCTLNTHKVDMDKLLGGQIGLEDFIFAHVKGQRKEVEVFKSEDALGLTITDNGAGYAFIK
Specifications

Specifications

GIPC PDZ domain containing family, member 1
Unconjugated
50% glycerol
NM_005716
C19orf3|GIPC|GLUT1CBP|Hs.6454|IIP-1|MGC15889|MGC3774|NIP|RGS19IP1|SEMCAP|SYNECTIIN|SYNECTIN|TIP-2
Mouse
50 uL
Signal Transduction
Y
Polyclonal
Human
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant GIPC1.
GIPC1
Serum
GIPC1
GIPC1 (NP_005707, 61 a.a. ~ 158 a.a) partial recombinant protein with GST tag.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
10755
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit