Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89004513

GIPC PDZ domain containing family, member 1 (A02), Mouse anti-Human, Polyclonal Antibody, Abnova™

Catalog No. 89004513 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-004-513 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-004-513 Supplier Abnova Corporation Supplier No. H00010755A02
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a partial recombinant GIPC1.

GIPC1 is a scaffolding protein that regulates cell surface receptor expression and trafficking (Lee et al., 2008 [PubMed 18775991]).[supplied by OMIM

Sequence: HTQLAHGSPTGRIEGFTNVKELYGKIAEAFRLPTAEVMFCTLNTHKVDMDKLLGGQIGLEDFIFAHVKGQRKEVEVFKSEDALGLTITDNGAGYAFIK

Specifications

Antigen GIPC PDZ domain containing family, member 1
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant GIPC1.
Formulation 50% glycerol
Gene GIPC1
Gene Accession No. NM_005716
Gene Alias C19orf3/GIPC/GLUT1CBP/Hs.6454/IIP-1/MGC15889/MGC3774/NIP/RGS19IP1/SEMCAP/SYNECTIIN/SYNECTIN/TIP-2
Gene Symbols GIPC1
Host Species Mouse
Immunogen GIPC1 (NP_005707, 61 a.a. ∼ 158 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 10755
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.