gap junction protein, alpha 1, 43kDa, Mouse, Clone: 3E5, Abnova™

Catalog No.	Quantity
89-014-115	100 μg

Catalog No. 89-014-115 Supplier Abnova Corporation Supplier No. H00002697M01

Description

Mouse monoclonal antibody raised against a partial recombinant GJA1.

This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. The encoded protein is the major protein of gap junctions in the heart that are thought to have a crucial role in the synchronized contraction of the heart and in embryonic development. A related intronless pseudogene has been mapped to chromosome 5. Mutations in this gene have been associated with oculodentodigital dysplasia and heart malformations. [provided by RefSeq

Sequence: GSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVD*

Specifications

• Antigen: gap junction protein, alpha 1, 43kDa
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3E5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant GJA1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: GJA1
• Gene Accession No.: BC026329
• Gene Alias: CX43/DFNB38/GJAL/ODDD
• Gene Symbols: GJA1
• Host Species: Mouse
• Immunogen: GJA1 (AAH26329, 261 a.a. ∼ 361 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2697
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ