Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

gap junction protein, alpha 1, 43kDa, Mouse, Clone: 3E5, Abnova™

Catalog No. 89014115 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-115 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-115 Supplier Abnova Corporation Supplier No. H00002697M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant GJA1.

This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. The encoded protein is the major protein of gap junctions in the heart that are thought to have a crucial role in the synchronized contraction of the heart and in embryonic development. A related intronless pseudogene has been mapped to chromosome 5. Mutations in this gene have been associated with oculodentodigital dysplasia and heart malformations. [provided by RefSeq

Sequence: GSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVD*

Specifications

Antigen gap junction protein, alpha 1, 43kDa
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3E5
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant GJA1.
Formulation PBS with no preservative; pH 7.4
Gene GJA1
Gene Accession No. BC026329
Gene Alias CX43/DFNB38/GJAL/ODDD
Gene Symbols GJA1
Host Species Mouse
Immunogen GJA1 (AAH26329, 261 a.a. ∼ 361 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2697
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.