GJB1, Mouse, Clone: 1F5, Abnova™

Catalog No.	Quantity
89-022-311	100 μg

Catalog No. 89-022-311 Supplier Abnova Corporation Supplier No. H00002705M08

Description

Mouse monoclonal antibody raised against a partial recombinant GJB1.

This gene encodes a member of the gap junction protein family. The gap junction proteins are membrane-spanning proteins that assemble to form gap junction channels that facilitate the transfer of ions and small molecules between cells. According to sequence similarities at the nucleotide and amino acid levels, the gap junction proteins are divided into two categories, alpha and beta. Mutations in this gene cause X-linked Charcot-Marie-Tooth disease, an inherited peripheral neuropathy. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq

Sequence: RLWSLQLILVSTPALLVAMHVAHQQHIEKKMLRLEGHGDPLHLEEVKRHKVHISGTLWWTYVISVVFRLLFEAVFMYVFYLLYPGYAMVRLVKCDVYPCP

Specifications

• Antigen: GJB1
• Applications: ELISA
• Classification: Monoclonal
• Clone: 1F5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant GJB1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: GJB1
• Gene Accession No.: BC022426
• Gene Alias: CMTX/CMTX1/CX32
• Gene Symbols: GJB1
• Host Species: Mouse
• Immunogen: GJB1 (AAH22426, 75 a.a. ∼ 174 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2705
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ