glycerol kinase, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-135	50 μL

Catalog No. 89-004-135 Supplier Abnova Corporation Supplier No. H00002710A01

Description

Mouse polyclonal antibody raised against a partial recombinant GK.

The product of this gene belongs to the FGGY kinase family of proteins and encodes glycerol kinase. Glycerol kinase is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Defects in this gene are the cause of glycerol kinase deficiency (GKD). Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq

Sequence: AASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEKTCEKLGQLNIDISNIKAIGVSNQR

Specifications

• Antigen: glycerol kinase
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant GK.
• Formulation: 50% glycerol
• Gene: GK
• Gene Accession No.: NM_000167
• Gene Alias: GK1/GKD
• Gene Symbols: GK
• Host Species: Mouse
• Immunogen: GK (NP_000158, 2 a.a. ∼ 94 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 2710
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum