Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

G kinase anchoring protein 1, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89004725 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-004-725 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-004-725 Supplier Abnova Corporation Supplier No. H00080318A01
Add to Cart
Add to Cart

Mouse polyclonal antibody raised against a partial recombinant GKAP1.

This gene encodes a protein that is highly similar to the mouse cGMP-dependent protein kinase anchoring protein 42kDa. The mouse protein has been found to localize with the Golgi and recruit cGMP-dependent protein kinase I alpha to the Golgi in mouse testes. It is thought to play a role in germ cell development. Transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: AENTSTQSKVMNKKDKRKNHQGKDRPLTVSLKDFHSEDHISKKTEELSSSQTLSHDGGFFNRLEDDVHKILIREKRREQLTEYNGTDNCTAHEHNQEVVL

Specifications

Antigen G kinase anchoring protein 1
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant GKAP1.
Formulation 50% glycerol
Gene GKAP1
Gene Accession No. NM_025211
Gene Alias FKSG21/FLJ25469/GKAP42
Gene Symbols GKAP1
Host Species Mouse
Immunogen GKAP1 (NP_079487, 151 a.a. ∼ 250 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 80318
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.