Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89014116

galactosidase, beta 1, Mouse, Clone: 6E7, Abnova™

Catalog No. 89014116 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-116 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-116 Supplier Abnova Corporation Supplier No. H00002720M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant GLB1.

This gene encodes beta-galactosidase-1, a lysosomal enzyme that hydrolyzes the terminal beta-galactose from ganglioside substrates and other glycoconjugates. Defects in this gene are the cause of GM1-gangliosidosis and Morquio B syndrome. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: KGQVWINGFNLGRYWPARGPQLTLFVPQHILMTSAPNTITVLELEWAPCSSDDPELCAVTFVDRPVIGSSVTYDHPSKPVEKRLMPPPPQKNKDSWLDHV

Specifications

Antigen galactosidase, beta 1
Applications ELISA, Immunoprecipitation, Western Blot
Classification Monoclonal
Clone 6E7
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant GLB1.
Formulation PBS with no preservative; pH 7.4
Gene GLB1
Gene Accession No. NM_000404
Gene Alias EBP/ELNR1
Gene Symbols GLB1
Host Species Mouse
Immunogen GLB1 (NP_000395, 578 a.a. ∼ 677 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2720
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.