GLE1, Mouse, Clone: 1D8, Abnova™

Catalog No.	Quantity
89-022-320	100 μg

Catalog No. 89-022-320 Supplier Abnova Corporation Supplier No. H00002733M03

Description

Mouse monoclonal antibody raised against a partial recombinant GLE1.

This gene encodes a predicted 75kDa polypeptide with high sequence and structure homology to yeast Gle1p, which is nuclear protein with a leucine-rich nuclear export sequence essential for poly(A)+RNA export. Inhibition of human GLE1L by microinjection of antibodies against GLE1L in HeLa cells resulted in inhibition of poly(A)+RNA export. Immunoflourescence studies show that GLE1L is localized at the nuclear pore complexes. This localization suggests that GLE1L may act at a terminal step in the export of mature RNA messages to the cytoplasm. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: RMKGTEGLRLWQEEQERKVQALSEMASEQLKRFDEWKELKQHKEFQDLREVMEKSSREALGHQEKLKAEHRHRAKILNLKLREAEQQRVKQAEQERLRKEE

Specifications

• Antigen: GLE1
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 1D8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant GLE1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: GLE1
• Gene Accession No.: NM_001003722
• Gene Alias: GLE1L/LCCS/LCCS1/hGLE1
• Gene Symbols: GLE1
• Host Species: Mouse
• Immunogen: GLE1 (NP_001003722.1, 140 a.a. ∼ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2733
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ