Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GLI-Kruppel family member GLI3, Mouse, Clone: 2C9, Abnova™

Catalog No. 89019025 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-019-025 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-019-025 Supplier Abnova Corporation Supplier No. H00002737M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant GLI3.

This gene encodes a protein which belongs to the C2H2-type zinc finger proteins subclass of the Gli family. They are characterized as DNA-binding transcription factors and are mediators of Sonic hedgehog (Shh) signaling. The protein encoded by this gene localizes in the cytoplasm and activates patched Drosophila homolog (PTCH) gene expression. It is also thought to play a role during embryogenesis. Mutations in this gene have been associated with several diseases, including Greig cephalopolysyndactyly syndrome, Pallister-Hall syndrome, preaxial polydactyly type IV, and postaxial polydactyly types A1 and B. [provided by RefSeq

Sequence: MEAQSHSSTTTEKKKVENSIVKCSTRTDVSEKAVASSTTSNEDESPGQTYHRERRNAITMQPQNVQGLSKVSEEPSTSSDERASLIKKEIHGSLPHVAEPSVPYRGTVFA

Specifications

Antigen GLI-Kruppel family member GLI3
Applications ELISA, Immunofluorescence, In situ PLA, Western Blot
Classification Monoclonal
Clone 2C9
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant GLI3.
Formulation PBS with no preservative; pH 7.4
Gene GLI3
Gene Accession No. NM_000168
Gene Alias ACLS/GCPS/PAP-A/PAPA/PAPA1/PAPB/PHS/PPDIV
Gene Symbols GLI3
Host Species Mouse
Immunogen GLI3 (NP_000159, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2737
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.