GLI pathogenesis-related 1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-526	50 μL

Catalog No. 89-004-526 Supplier Abnova Corporation Supplier No. H00011010A01

Description

Mouse polyclonal antibody raised against a partial recombinant GLIPR1.

This gene encodes a protein with similarity to both the pathogenesis-related protein (PR) superfamily and the cysteine-rich secretory protein (CRISP) family. Increased expression of this gene is associated with myelomocytic differentiation in macrophage and decreased expression of this gene through gene methylation is associated with prostate cancer. The protein has proapoptotic activities in prostate and bladder cancer cells. This gene is a member of a cluster on chromosome 12 containing two other similar genes. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq

Sequence: NILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGEN

Specifications

• Antigen: GLI pathogenesis-related 1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant GLIPR1.
• Formulation: 50% glycerol
• Gene: GLIPR1
• Gene Accession No.: NM_006851
• Gene Alias: CRISP7/GLIPR/RTVP1
• Gene Symbols: GLIPR1
• Host Species: Mouse
• Immunogen: GLIPR1 (NP_006842, 23 a.a. ∼ 99 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 11010
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum