Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Our pricing system is unavailable. You are viewing list price.
Please call 1-800-766-7000 to place your order or try our site again later.

glioma tumor suppressor candidate region gene 2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant GLTSCR2.

Manufacturer:  Abnova Corporation H00029997A01

Catalog No. 89-004-609



Description

Description

Sequence: KPRRLGRLKYQAPDIDVQLSSELTDSLRTLKPEGNILRDRFKSFQRRNMIEPRERAKFKRKYKVKLVEKRAFREIQL
Specifications

Specifications

glioma tumor suppressor candidate region gene 2
Unconjugated
50% glycerol
NM_015710
PICT-1|PICT1
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
29997
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant GLTSCR2.
GLTSCR2
Serum
GLTSCR2
GLTSCR2 (NP_056525, 402 a.a. ~ 478 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit