GM2A, Mouse, Clone: 2C8, Abnova™

Catalog No.	Quantity
89-022-338	100 μg

Catalog No. 89-022-338 Supplier Abnova Corporation Supplier No. H00002760M02

Description

Mouse monoclonal antibody raised against a partial recombinant GM2A.

This gene encodes a small glycolipid transport protein which acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A. Beta-hexosaminidase A, together with GM2 ganglioside activator, catalyzes the degradation of the ganglioside GM2, and other molecules containing terminal N-acetyl hexosamines. Mutations in this gene result in GM2-gangliosidosis type AB or the AB variant of Tay-Sachs disease. [provided by RefSeq

Sequence: WIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI

Specifications

• Antigen: GM2A
• Applications: ELISA
• Classification: Monoclonal
• Clone: 2C8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant GM2A.
• Formulation: PBS with no preservative; pH 7.4
• Gene: GM2A
• Gene Accession No.: NM_000405
• Gene Alias: SAP-3
• Gene Symbols: GM2A
• Host Species: Mouse
• Immunogen: GM2A (NP_000396.2, 94 a.a. ∼ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2760
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2b κ