GNB3, Mouse, Clone: M1-1-1D5, Abnova™

Catalog No.	Quantity
89-022-344	100 μg

Catalog No. 89-022-344 Supplier Abnova Corporation Supplier No. H00002784M01

Description

Mouse monoclonal antibody raised against a full-length recombinant GNB3.

Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. A single-nucleotide polymorphism (C825T) in this gene is associated with essential hypertension and obesity. This polymorphism is also associated with the occurrence of the splice variant GNB3-s, which appears to have increased activity. GNB3-s is an example of alternative splicing caused by a nucleotide change outside of the splice donor and acceptor sites. Additional splice variants may exist for this gene, but they have not been fully described. [provided by RefSeq

Sequence: MGEMEQLRQEAEQLKKQIADARKACAGVTLAELVSGLEVVGRVQMRTRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNMCSIYNLKSREGNVKVSRELSAHTGYLSCCRFLDDNNIVTSSGDTTCALWDIETGQQKTVFVGHTGDCMSLAVSPDFNLFISGACDASAKLWDVREGTCRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQELICFSHESIICSITSVAFSLSGRLLFAGYDDFNCNVWDSMKSERVGILSGHDNRVSCLGVTADGMAVATGSWDSFLKIWN

Specifications

• Antigen: GNB3
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: M1-1-1D5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant GNB3.
• Formulation: PBS with no preservative; pH 7.4
• Gene: GNB3
• Gene Accession No.: BC002454
• Gene Symbols: GNB3
• Host Species: Mouse
• Immunogen: GNB3 (AAH02454, 1 a.a. ∼ 340 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2784
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ