Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GNG11, Mouse, Clone: 2H5, Abnova™

Catalog No. 89022349 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-022-349 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-022-349 Supplier Abnova Corporation Supplier No. H00002791M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant GNG11.

This gene is a member of the guanine nucleotide-binding protein (G protein) gamma family and encodes a lipid-anchored, cell membrane protein. As a member of the heterotrimeric G protein complex, this protein plays a role in this transmembrane signaling system. This protein is also subject to carboxyl-terminal processing. Decreased expression of this gene is associated with splenic marginal zone lymphomas. [provided by RefSeq

Sequence: MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGS

Specifications

Antigen GNG11
Applications ELISA, In situ PLA, Western Blot
Classification Monoclonal
Clone 2H5
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant GNG11.
Formulation PBS with no preservative; pH 7.4
Gene GNG11
Gene Accession No. NM_004126
Gene Alias GNGT11
Gene Symbols GNG11
Host Species Mouse
Immunogen GNG11 (NP_004117.1, 1 a.a. ∼ 69 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2791
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.