GNGT1, Mouse, Clone: 1F8, Abnova™

Catalog No.	Quantity
89-022-350	100 μg

Catalog No. 89-022-350 Supplier Abnova Corporation Supplier No. H00002792M01

Description

Mouse monoclonal antibody raised against a full-length recombinant GNGT1.

Heterotrimeric guanine nucleotide-binding proteins (G proteins) transduce extracellular signals received by transmembrane receptors to effector proteins. Transducin is a guanine nucleotide-binding protein found specifically in rod outer segments, where it mediates activation by rhodopsin of a cyclic GTP-specific (guanosine monophosphate) phosphodiesterase. Transducin is also referred to as GMPase. GNGT1 encodes the gamma subunit of transducin (Hurley et al., 1984 [PubMed 6438626]; Scherer et al., 1996 [PubMed 8661128]).[supplied by OMIM

Sequence: MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGGCVIS

Specifications

• Antigen: GNGT1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1F8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant GNGT1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: GNGT1
• Gene Accession No.: BC029367
• Gene Alias: GNG1
• Gene Symbols: GNGT1
• Host Species: Mouse
• Immunogen: GNGT1 (AAH29367, 1 a.a. ∼ 74 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2792
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ