Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89022351

GNGT2, Mouse, Clone: 1G11-C7, Abnova™

Catalog No. 89022351 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-022-351 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-022-351 Supplier Abnova Corporation Supplier No. H00002793M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a full-length recombinant GNGT2.

Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. The encoded protein is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones. There is evidence for use of multiple polyadenylation sites by this gene. [provided by RefSeq

Sequence: MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS

Specifications

Antigen GNGT2
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1G11-C7
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant GNGT2.
Formulation PBS with no preservative; pH 7.4
Gene GNGT2
Gene Accession No. BC008663
Gene Alias G-GAMMA-8/G-GAMMA-C/GNG8/GNG9/GNGT8
Gene Symbols GNGT2
Host Species Mouse
Immunogen GNGT2 (AAH08663, 1 a.a. ∼ 69 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2793
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.