guanine nucleotide binding protein-like 3 (nucleolar), Mouse, Clone: 1A1, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant GNL3.

Supplier:  Abnova Corporation H00026354M01

Catalog No. 89-001-243

Description

Sequence: IEVVKPMEAASAILSQADARQVVLKYTVPGYRNSLEFFTMLAQRRGMHQKGGIPNVEGAAKLLWSEWTGASLAYYCHPPTSWTPPPYFNESIVVDMKSGF

Specifications

• Antigen: guanine nucleotide binding protein-like 3 (nucleolar)
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC001024
• Gene Symbols: GNL3
• Immunogen: GNL3 (AAH01024.1, 328 a.a. ∼ 427 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Whole Molecule: Yes
• Gene ID (Entrez): 26354
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

• Applications: ELISA, Western Blot
• Clone: 1A1
• Description: Mouse monoclonal antibody raised against a full length recombinant GNL3.
• Gene: GNL3
• Gene Alias: C77032/E2IG3/MGC800/NS
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody