Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89022355

GOT2, Mouse, Clone: 4H8, Abnova™

Catalog No. 89022355 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-022-355 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-022-355 Supplier Abnova Corporation Supplier No. H00002806M09
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant GOT2.

Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. [provided by RefSeq

Sequence: LNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQVTK

Specifications

Antigen GOT2
Applications ELISA, Western Blot
Classification Monoclonal
Clone 4H8
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant GOT2.
Formulation PBS with no preservative; pH 7.4
Gene GOT2
Gene Accession No. NM_002080
Gene Alias FLJ40994/KAT4/KATIV/mitAAT
Gene Symbols GOT2
Host Species Mouse
Immunogen GOT2 (NP_002071, 331 a.a. ∼ 430 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2806
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.