Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant GOT2.

Manufacturer:  Abnova Corporation H00002806A01

Catalog No. 89-004-140


Add to cart

Description

Description

Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. [provided by RefSeq

Sequence: LNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQVTK
Specifications

Specifications

glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2)
Unconjugated
50% glycerol
NM_002080
FLJ40994|KAT4|KATIV|mitAAT
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
2806
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant GOT2.
GOT2
Serum
GOT2
GOT2 (NP_002071, 331 a.a. ~ 430 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human, Murine, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit