glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant GOT2.

Supplier:  Abnova Corporation H00002806A01

Catalog No. 89-004-140

Description

Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. [provided by RefSeq

Sequence: LNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQVTK

Specifications

• Antigen: glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2)
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant GOT2.
• Gene: GOT2
• Gene Alias: FLJ40994/KAT4/KATIV/mitAAT
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 2806
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_002080
• Gene Symbols: GOT2
• Immunogen: GOT2 (NP_002071, 331 a.a. ∼ 430 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Serum