GP1BA, Mouse, Clone: 1C6, Abnova™

Catalog No.	Quantity
89-022-359	100 μg

Catalog No. 89-022-359 Supplier Abnova Corporation Supplier No. H00002811M02

Description

Mouse monoclonal antibody raised against a partial recombinant GP1BA.

Glycoprotein Ib (GP Ib) is a platelet surface membrane glycoprotein composed of a heterodimer, an alpha chain and a beta chain, that are linked by disulfide bonds. The Gp Ib functions as a receptor for von Willebrand factor (VWF). The complete receptor complex includes noncovalent association of the alpha and beta subunits with platelet glycoprotein IX and platelet glycoprotein V. The binding of the GP Ib-IX-V complex to VWF facilitates initial platelet adhesion to vascular subendothelium after vascular injury, and also initiates signaling events within the platelet that lead to enhanced platelet activation, thrombosis, and hemostasis. This gene encodes the alpha subunit. Several polymorphisms and mutations have been described in this gene, some of which are the cause of Bernard-Soulier syndromes and platelet-type von Willebrand disease. [provided by RefSeq

Sequence: ICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVPFNRL

Specifications

• Antigen: GP1BA
• Applications: ELISA, Immunoprecipitation, Western Blot
• Classification: Monoclonal
• Clone: 1C6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant GP1BA.
• Formulation: PBS with no preservative; pH 7.4
• Gene: GP1BA
• Gene Accession No.: BC027955
• Gene Alias: BSS/CD42B/CD42b-alpha/GP1B/MGC34595
• Gene Symbols: GP1BA
• Host Species: Mouse
• Immunogen: GP1BA (AAH27955, 19 a.a. ∼ 128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2811
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ