gephyrin, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-481	50 μL

Catalog No. 89-004-481 Supplier Abnova Corporation Supplier No. H00010243A01

Description

Mouse polyclonal antibody raised against a partial recombinant GPHN.

This gene encodes a neuronal assembly protein that anchors inhibitory neurotransmitter receptors to the postsynaptic cytoskeleton via high affinity binding to a receptor subunit domain and tubulin dimers. In nonneuronal tissues, the encoded protein is also required for molybdenum cofactor biosynthesis. Mutations in this gene may be associated with the neurological condition hyperplexia and also lead to molybdenum cofactor deficiency. Numerous alternatively spliced transcript variants encoding different isoforms have been described; however, the full-length nature of all transcript variants is not currently known. [provided by RefSeq

Sequence: RKMQGILDPRPTIIKARLSCDVKLDPRPEYHRCILTWHHQEPLPWAQSTGNQMSSRLMSMRSANGLLMLPPKTEQYVELHKGEVVDVMVIGRL

Specifications

• Antigen: gephyrin
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant GPHN.
• Formulation: 50% glycerol
• Gene: GPHN
• Gene Accession No.: NM_020806
• Gene Alias: GEPH/GPH/GPHRYN/KIAA1385
• Gene Symbols: GPHN
• Host Species: Mouse
• Immunogen: GPHN (NP_065857, 677 a.a. ∼ 769 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 10243
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum