GPR24, Mouse, Clone: 3D7, Abnova™

Mouse monoclonal antibody raised against a partial recombinant GPR24.

Supplier:  Abnova Corporation H00002847M01

Catalog No. 89-022-365

Description

The protein encoded by this gene, a member of the G protein-coupled receptor family 1, is an integral plasma membrane protein which binds melanin-concentrating hormone. The encoded protein can inhibit cAMP accumulation and stimulate intracellular calcium flux, and is probably involved in the neuronal regulation of food consumption. Although structurally similar to somatostatin receptors, this protein does not seem to bind somatostatin. [provided by RefSeq

Sequence: VGLGGGSGCQATEEDPLPDCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMP

Specifications

• Antigen: GPR24
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC001736
• Gene Symbols: MCHR1
• Immunogen: GPR24 (AAH01736, 14 a.a. ∼ 113 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ

• Applications: ELISA, Western Blot
• Clone: 3D7
• Description: Mouse monoclonal antibody raised against a partial recombinant GPR24.
• Gene: MCHR1
• Gene Alias: GPR24/MCH1R/MGC32129/SLC1
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 2847
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid