GPS2, Mouse, Clone: 3C4, Abnova™

Catalog No.	Quantity
89-022-377	100 μg

Catalog No. 89-022-377 Supplier Abnova Corporation Supplier No. H00002874M01

Description

Mouse monoclonal antibody raised against a partial recombinant GPS2.

This gene encodes a protein involved in G protein-mitogen-activated protein kinase (MAPK) signaling cascades. When overexpressed in mammalian cells, this gene could potently suppress a RAS- and MAPK-mediated signal and interfere with JNK activity, suggesting that the function of this gene may be signal repression. The encoded protein is an integral subunit of the NCOR1-HDAC3 (nuclear receptor corepressor 1-histone deacetylase 3) complex, and it was shown that the complex inhibits JNK activation through this subunit and thus could potentially provide an alternative mechanism for hormone-mediated antagonism of AP1 (activator protein 1) function. [provided by RefSeq

Sequence: QPYAVHGHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALHPAPGLLASPQLPVQMQPAGKSGFAATSQPGPRLPFIQHSQNPRFYHK

Specifications

• Antigen: GPS2
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3C4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant GPS2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: GPS2
• Gene Accession No.: BC013652
• Gene Alias: AMF-1/MGC104294/MGC119287/MGC119288/MGC119289
• Gene Symbols: GPS2
• Host Species: Mouse
• Immunogen: GPS2 (AAH13652, 228 a.a. ∼ 327 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2874
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ