glutamic pyruvate transaminase (alanine aminotransferase) 2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant GPT2.

Supplier:  Abnova Corporation H00084706A01

Catalog No. 89-004-745

Description

GPT (MIM 138200) and GPT2 (EC 2.6.1.2), also known as alanine transaminases, are pyridoxal enzymes that catalyze the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate. By mediating the conversion of these 4 major intermediate metabolites, these transaminases have roles in gluconeogenesis and in amino acid metabolism.[supplied by OMIM

Sequence: NLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLAKKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIFIPAKAVEAAQ

Specifications

• Antigen: glutamic pyruvate transaminase (alanine aminotransferase) 2
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant GPT2.
• Gene: GPT2
• Gene Alias: ALT2
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 84706
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_133443
• Gene Symbols: GPT2
• Immunogen: GPT2 (NP_597700, 358 a.a. ∼ 456 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum