GRB7, Mouse, Clone: 3C12, Abnova™

Catalog No.	Quantity
89-022-381	100 μg

Catalog No. 89-022-381 Supplier Abnova Corporation Supplier No. H00002886M03

Description

Mouse monoclonal antibody raised against a partial recombinant GRB7.

The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with epidermal growth factor receptor (EGFR) and ephrin receptors. The protein plays a role in the integrin signaling pathway and cell migration by binding with focal adhesion kinase (FAK). Alternative splicing results in multiple transcript variants encoding different isoforms, although the full-length natures of only two of the variants have been determined to date. [provided by RefSeq

Sequence: EEVKRSQPLLIPTTGRKLREEERRATSLPSIPNPFPELCSPPSQSPILGGPSSARGLLPRDASRPHVVKVYSEDGACRSVEVAAGATARHVCEMLVQRAH

Specifications

• Antigen: GRB7
• Applications: ELISA, Immunoprecipitation, Western Blot
• Classification: Monoclonal
• Clone: 3C12
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant GRB7.
• Formulation: PBS with no preservative; pH 7.4
• Gene: GRB7
• Gene Accession No.: BC006535
• Gene Symbols: GRB7
• Host Species: Mouse
• Immunogen: GRB7 (AAH06535, 37 a.a. ∼ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2886
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2b λ