GRIA1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-003-289	50 μL

Catalog No. 89-003-289 Supplier Abnova Corporation Supplier No. H00002890A01

Description

Mouse polyclonal antibody raised against a partial recombinant GRIA1.

Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes with multiple subunits, each possessing transmembrane regions, and all arranged to form a ligand-gated ion channel. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. This gene belongs to a family of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate (AMPA) receptors. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: VVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM

Specifications

• Antigen: GRIA1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant GRIA1.
• Formulation: 50% glycerol
• Gene: GRIA1
• Gene Accession No.: NM_000827
• Gene Alias: GLUH1/GLUR1/GLURA/HBGR1/MGC133252
• Gene Symbols: GRIA1
• Host Species: Mouse
• Immunogen: GRIA1 (NP_000818, 201 a.a. ∼ 300 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2890
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid