glutamate receptor, ionotrophic, AMPA 3, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-005-472	50 μL

Catalog No. 89-005-472 Supplier Abnova Corporation Supplier No. H00002892B01

Description

Mouse polyclonal antibody raised against a full-length human GRIA3 protein.

Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes composed of multiple subunits, arranged to form ligand-gated ion channels. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. The subunit encoded by this gene belongs to a family of AMPA (alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate)-sensitive glutamate receptors, and is subject to RNA editing (AGA->GGA; R->G). Alternative splicing at this locus results in different isoforms, which may vary in their signal transduction properties. [provided by RefSeq

Sequence: MARQKKMGQSVLRAVFFLVLGLLGHSHGGFPNTISIGGLFMRNTVQEHSAFRFAVQLYNTNQNTTEKPFHLNYHVDHLDSSNSFSVTNACPAERDYLPWPGSIRENNWTALPCCKDHGLLHLKCSPGGARQNWAYCIWGVTGEL

Specifications

• Antigen: glutamate receptor, ionotrophic, AMPA 3
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human GRIA3 protein.
• Formulation: No additive
• Gene: GRIA3
• Gene Accession No.: NM_181894
• Gene Alias: GLUR-C/GLUR-K3/GLUR3/GLURC/MRX94
• Gene Symbols: GRIA3
• Host Species: Mouse
• Immunogen: GRIA3 (NP_871623, 1 a.a. ∼ 144 a.a) full-length human protein.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 2892
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum