GRIK3, Mouse, Clone: 4H1, Abnova™

Catalog No.	Quantity
89-022-389	100 μg

Catalog No. 89-022-389 Supplier Abnova Corporation Supplier No. H00002899M06

Description

Mouse monoclonal antibody raised against a partial recombinant GRIK3.

Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. This gene product belongs to the kainate family of glutamate receptors, which are composed of four subunits and function as ligand-activated ion channels. It is not certain if the subunit encoded by this gene is subject to RNA editing as the other 2 family members (GRIK1 and GRIK2). A Ser310Ala polymorphism has been associated with schizophrenia, and there are conflicting reports of its association with the pathogenesis of delirium tremens in alcoholics. [provided by RefSeq

Sequence: NLYPDYASLSHAILDLVQYLKWRSATVVYDDSTGLIRLQELIMAPSRYNIRLKIRQLPIDSDDSRPLLKEMKRGREFRIIFDCSHTMAAQILKQAMAMGM

Specifications

• Antigen: GRIK3
• Applications: ELISA
• Classification: Monoclonal
• Clone: 4H1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant GRIK3.
• Formulation: PBS with no preservative; pH 7.4
• Gene: GRIK3
• Gene Accession No.: NM_000831
• Gene Alias: EAA5/GLR7/GLUR7/GluR7a
• Gene Symbols: GRIK3
• Host Species: Mouse
• Immunogen: GRIK3 (NP_000822, 151 a.a. ∼ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2899
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ