GRIN1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-003-290	50 μL

Catalog No. 89-003-290 Supplier Abnova Corporation Supplier No. H00002902A01

Description

Mouse polyclonal antibody raised against a partial recombinant GRIN1.

The protein encoded by this gene is a critical subunit of N-methyl-D-aspartate receptors, members of the glutamate receptor channel superfamily which are heteromeric protein complexes with multiple subunits arranged to form a ligand-gated ion channel. These subunits play a key role in the plasticity of synapses, which is believed to underlie memory and learning. Cell-specific factors are thought to control expression of different isoforms, possibly contributing to the functional diversity of the subunits. Alternatively spliced transcript variants have been described. [provided by RefSeq

Sequence: ACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQLNATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLG

Specifications

• Antigen: GRIN1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant GRIN1.
• Formulation: 50% glycerol
• Gene: GRIN1
• Gene Accession No.: NM_007327
• Gene Alias: NMDA1/NMDAR1/NR1
• Gene Symbols: GRIN1
• Host Species: Mouse
• Immunogen: GRIN1 (NP_015566, 21 a.a. ∼ 120 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2902
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid