glutamate receptor, ionotropic, N-methyl D-aspartate 2C, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-005-474	50 μL

Catalog No. 89-005-474 Supplier Abnova Corporation Supplier No. H00002905B01

Description

Mouse polyclonal antibody raised against a full-length human GRIN2C protein.

N-methyl-D-aspartate (NMDA) receptors are a class of ionotropic glutamate receptors. NMDA channel has been shown to be involved in long-term potentiation, an activity-dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning. NMDA receptor channels are heteromers composed of the key receptor subunit NMDAR1 (GRIN1) and 1 or more of the 4 NMDAR2 subunits: NMDAR2A (GRIN2A), NMDAR2B (GRIN2B), NMDAR2C (GRIN2C), and NMDAR2D (GRIN2D).

Sequence: MGGALGPALLLTSLFGAWAGLGPGQGEQGMTVAVVFSSSGPPQAQFRARLTPQSFLDLPLEIQPLTVGVNTTNPSSLLTQICGLLGAAHVHGIVFEDNVDTEAVAQILDFISSQTHVPILSISGGSAVVLTPKVHVQTHVPSCLRPGTRLGSGVLWFWEAGIRRDGQGGGG

Specifications

• Antigen: glutamate receptor, ionotropic, N-methyl D-aspartate 2C
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human GRIN2C protein.
• Formulation: No additive
• Gene: GRIN2C
• Gene Accession No.: BC059384
• Gene Alias: NMDAR2C/NR2C
• Gene Symbols: GRIN2C
• Host Species: Mouse
• Immunogen: GRIN2C (AAH59384, 1 a.a. ∼ 171 a.a) full-length human protein.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 2905
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum