Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

G protein-coupled receptor kinase 5, Mouse, Clone: 5E11, Abnova™

Catalog No. 89000693 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-693 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-693 Supplier Abnova Corporation Supplier No. H00002869M03
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant GRK5.

This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs). [provided by RefSeq

Sequence: RDYCSLCDKQPIGRLLFRQFCETRPGLECYIQFLDSVAEYEVTPDEKLGEKGKEIMTKYLTPKSPVFIAQVGQDLVSQTEEKLLQKPCKELFSACAQSVH

Specifications

Antigen G protein-coupled receptor kinase 5
Applications ELISA
Classification Monoclonal
Clone 5E11
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant GRK5.
Formulation PBS with no preservative; pH 7.4
Gene GRK5
Gene Accession No. BC064506
Gene Alias GPRK5
Gene Symbols GRK5
Host Species Mouse
Immunogen GRK5 (AAH64506, 51 a.a. ∼ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Kinases
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 2869
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.