Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GRK6, Mouse, Clone: 8D9, Abnova™

Catalog No. 89022374 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-022-374 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-022-374 Supplier Abnova Corporation Supplier No. H00002870M09
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant GRK6.

This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. Several transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq

Sequence: CATRPELSRCVAFLDGVAEYEVTPDDKRKACGRQLTQNFLSHTGPDLIPEVPRQLVTNCTQRLEQGPCKDLFQELTRLTHEYLSVAPFADYLDSIYFNRF

Specifications

Antigen GRK6
Applications ELISA, Western Blot
Classification Monoclonal
Clone 8D9
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant GRK6.
Formulation PBS with no preservative; pH 7.4
Gene GRK6
Gene Accession No. BC017272
Gene Alias FLJ32135/GPRK6
Gene Symbols GRK6
Host Species Mouse
Immunogen GRK6 (AAH17272, 71 a.a. ∼ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2870
Target Species Human, Mouse
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.