GRLF1, Mouse, Clone: 4D4-F8, Abnova™

Catalog No.	Quantity
89-022-392	100 μg

Catalog No. 89-022-392 Supplier Abnova Corporation Supplier No. H00002909M01

Description

Mouse monoclonal antibody raised against a full-length recombinant GRLF1.

The human glucocorticoid receptor DNA binding factor, which associates with the promoter region of the glucocorticoid receptor gene (hGR gene), is a repressor of glucocorticoid receptor transcription. The amino acid sequence deduced from the cDNA sequences show the presence of three sequence motifs characteristic of a zinc finger and one motif suggestive of a leucine zipper in which 1 cysteine is found instead of all leucines. The GRLF1 enhances the homologous down-regulation of wild-type hGR gene expression. Biochemical analysis suggests that GRLF1 interaction is sequence specific and that transcriptional efficacy of GRLF1 is regulated through its interaction with specific sequence motif. The level of expression is regulated by glucocorticoids. [provided by RefSeq

Sequence: MEATSRSVHGDVGEVGHFEGMAVCWCPRRGILPGLR

Specifications

• Antigen: GRLF1
• Applications: ELISA
• Classification: Monoclonal
• Clone: 4D4-F8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant GRLF1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: GRLF1
• Gene Accession No.: BC003514
• Gene Alias: GRF-1/KIAA1722/MGC10745/P190-A/P190A/p190RhoGAP
• Gene Symbols: GRLF1
• Host Species: Mouse
• Immunogen: GRLF1 (AAH03514, 1 a.a. ∼ 36 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2909
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ