GRM6, Mouse, Clone: 1A11, Abnova™

Catalog No.	Quantity
89-022-397	100 μg

Catalog No. 89-022-397 Supplier Abnova Corporation Supplier No. H00002916M01

Description

Mouse monoclonal antibody raised against a partial recombinant GRM6.

L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5 and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3 while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities. [provided by RefSeq

Sequence: ATNGSASSGGYQAVGQWAETLRLDVEALQWSGDPHEVPSSLCSLPCGPGERKKMVKGVPCCWHCEACDGYRFQVDEFTCEACPGDMRPTP

Specifications

• Antigen: GRM6
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1A11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant GRM6.
• Formulation: PBS with no preservative; pH 7.4
• Gene: GRM6
• Gene Accession No.: NM_000843
• Gene Alias: CSNB1B/DKFZp686H1993/GPRC1F/MGLUR6/mGlu6
• Gene Symbols: GRM6
• Host Species: Mouse
• Immunogen: GRM6 (NP_000834, 477 a.a. ∼ 566 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2916
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ