G-rich RNA sequence binding factor 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant GRSF1.

Supplier:  Abnova Corporation H00002926A01

Catalog No. 89-004-144

Description

The protein encoded by this gene is a cellular protein that binds RNAs containing the G-rich element. The protein is localized in the cytoplasm, and has been shown to stimulate translation of viral mRNAs in vitro. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: EEEVDDVFLIRAQGLPWSCTMEDVLNFFSDCRIRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEVYEINNEDVDALMKSLQ

Specifications

• Antigen: G-rich RNA sequence binding factor 1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant GRSF1.
• Gene: GRSF1
• Gene Alias: FLJ13125
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 2926
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_002092
• Gene Symbols: GRSF1
• Immunogen: GRSF1 (NP_002083, 87 a.a. ∼ 184 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum