Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001396

goosecoid homeobox, Mouse, Clone: 3D11, Abnova™

Catalog No. 89001396 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-396 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-396 Supplier Abnova Corporation Supplier No. H00145258M03
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant GSC.

This gene encodes a member of the bicoid subfamily of the paired (PRD) homeobox family of proteins. The encoded protein acts as a transcription factor and may be autoregulatory. A similar protein in mice plays a role in craniofacial and rib cage development during embryogenesis. [provided by RefSeq

Sequence: LLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAEKWNKTSSSKASPEKREEEGKSDLDSDS

Specifications

Antigen goosecoid homeobox
Applications ELISA, KnockDown, Western Blot
Classification Monoclonal
Clone 3D11
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant GSC.
Formulation PBS with no preservative; pH 7.4
Gene GSC
Gene Accession No. NM_173849
Gene Symbols GSC
Host Species Mouse
Immunogen GSC (NP_776248, 151 a.a. ∼ 257 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Transcription Regulation
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 145258
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.