glycogen synthase kinase 3 beta, Mouse, Clone: 1H3, Abnova™

Catalog No.	Quantity
89-014-119	100 μg

Catalog No. 89-014-119 Supplier Abnova Corporation Supplier No. H00002932M04

Description

Mouse monoclonal antibody raised against a partial recombinant GSK3B.

The protein encoded by this gene is a serine-threonine kinase, belonging to the glycogen synthase kinase subfamily. It is involved in energy metabolism, neuronal cell development, and body pattern formation. Polymorphisms in this gene have been implicated in modifying risk of Parkinson disease, and studies in mice show that overexpression of this gene may be relevant to the pathogenesis of Alzheimer disease. Alternatively spliced transcript variants encoding different isoforms have been found for this gene

Sequence: MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQI

Specifications

• Antigen: glycogen synthase kinase 3 beta
• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), In situ PLA, Western Blot
• Classification: Monoclonal
• Clone: 1H3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant GSK3B.
• Formulation: PBS with no preservative; pH 7.4
• Gene: GSK3B
• Gene Accession No.: NM_002093
• Gene Symbols: GSK3B
• Host Species: Mouse
• Immunogen: GSK3B (NP_002084, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Kinases
• Primary or Secondary: Primary
• Gene ID (Entrez): 2932
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ