GSTA4, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-003-292	50 μL

Catalog No. 89-003-292 Supplier Abnova Corporation Supplier No. H00002941A01

Description

Mouse polyclonal antibody raised against a partial recombinant GSTA4.

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, which are located in a cluster on chromosome 6, are highly related and encode enzymes with glutathione peroxidase activity that function in the detoxification of lipid peroxidation products. Reactive electrophiles produced by oxidative metabolism have been linked to a number of degenerative diseases including Parkinson's disease, Alzheimer's disease, cataract formation, and atherosclerosis. [provided by RefSeq]

Sequence: EEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP

Specifications

• Antigen: GSTA4
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant GSTA4.
• Formulation: 50% glycerol
• Gene: GSTA4
• Gene Accession No.: NM_001512
• Gene Alias: DKFZp686D21185/GSTA4-4/GTA4
• Gene Symbols: GSTA4
• Host Species: Mouse
• Immunogen: GSTA4 (NP_001503, 168 a.a. ∼ 222 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2941
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid