glutathione S-transferase kappa 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human GSTK1 protein.

Manufacturer:  Abnova Corporation H00373156B01

Catalog No. 89-008-749

Description

This gene encodes a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. The encoded protein is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells. Alternative splicing results in multiple transcript variants

Sequence: MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL

Specifications

• Antigen: glutathione S-transferase kappa 1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human GSTK1 protein.
• Gene: GSTK1
• Gene Alias: GST/GST13/GST13-13/GSTK1-1
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 373156
• Form: Serum

• Applications: Immunofluorescence, Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: BC001231
• Gene Symbols: GSTK1
• Immunogen: GSTK1 (AAH01231, 1 a.a. ∼ 226 a.a) full-length human protein.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human